DPCstruct | MC5917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 180 ± 13 aa |
| Standard deviation of domain lengths | 13.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2U352 | 1-170 | MSRRKNGPIVEYLNNISAWHHISAQIVDYIQHPYRGLRAKSKRVDDLGNGSVLSSREAGYPLPVALIARYQLTTVDAFACEISIDDP… |
| R1EF56 | 243-412 | LRRSPGGEGSGGGTSLGEYIDVIAEWHGRTREMVEFITRAPGEEVGTPTPTERMVGEGAGEVRTPVLIMPTYNLGAADAWASRISIT… |
| A0A6A6Y4T1 | 839-1015 | None |
| A0A0B7K633 | 304-500 | None |
| A0A136IP46 | 873-1066 | None |
| A0A366NH84 | 125-315 | None |
| A0A0G2IEM3 | 48-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.