DPCstruct | MC59166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 207 ± 58 aa |
| Standard deviation of domain lengths | 58.24 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9BM14 | 46-303 | WEAYRGAYGNVREYLMILMGERELAPETFKLRRLDKTPKTNYEMAFDNLCENLWHQMSFYPATWLAMPYLARLMENWEKEKDREWLF… |
| A0A327YZ27 | 18-190 | AWTAIRRAQADASLLPWLARTAAGFDPRARDGVVVLAGILAVEATDEERATHSSEIAQLKSFAAELLPTMTDDEDYVILRQAMLALD… |
| A0A0Q8P8M1 | 21-259 | None |
| A0A559V102 | 4-294 | None |
| A0A351TR78 | 248-505 | None |
| A0A4P6MQX0 | 10-262 | None |
| A0A560WJG4 | 24-250 | None |
| A0A0R3M7T1 | 3-284 | None |
| A0A385DBG8 | 2-129 | None |
| A0A2T4VHE7 | 20-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.