DPCstruct | MC59165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 246 |
|---|---|
| Mean domain length (aa) | 146 ± 26 aa |
| Standard deviation of domain lengths | 26.40 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 10.95 |
| Pfam Score | 60.78 |
| Assigned Pfam label(s) | CL0691- PF14065- PF11863 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3C317 | 4-104 | QNLKNLLLTIGPPVFHYFASGQTRNYIVWAEDGEGASGHADNKKTTQVISGTIDYFTKDEFDPVTEQIQGKLNDSRISWRLNSVRHE… |
| A0A0X3TDT3 | 4-138 | VVIEMQQRLDATGAFAKVADSVALTELSAKLIHGQASAWVGELSSLPGQNTRDIGDPVQFEQQVFGVVIGVRSINDPHGSAAKQTLQ… |
| A0A0G0M6Z1 | 859-991 | None |
| A0A1Q6KJJ7 | 7-110 | None |
| A0A0M4CVP9 | 1-146 | None |
| A0A1H2TS52 | 9-189 | None |
| Q7VPF0 | 6-184 | None |
| A0A3S4D127 | 4-133 | None |
| A0A350PH60 | 47-231 | None |
| A0A1V5V515 | 4-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.