DPCstruct | MC5916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 217 ± 43 aa |
| Standard deviation of domain lengths | 42.99 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.89 |
| Pfam Score | 82.50 |
| Assigned Pfam label(s) | PF02666- PF12588 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q3BQ30 | 49-251 | QGPGYANQAVQDLANLIDTNGIVRMYVAEAIDQTSAFMKNIKNIQDMLEQLDFICTTAPEYNVNKKLRVLFPMSALFVDMMATPAGK… |
| A0A1Y2VRJ1 | 1-194 | MLASDMFTEIPKKFPYDKNPDGTSLIRDYKTMLLCFSGILNGVSPEWSRIGYDSGLIGFPFNAVLDWPMATPSGYAFFLDVEVNQHF… |
| A0A7D9EDQ3 | 6-176 | None |
| A0A2C5ZCB5 | 124-271 | None |
| A0A5N5QGY9 | 619-874 | None |
| A0A517LP37 | 602-824 | None |
| A0A517LJM0 | 114-325 | None |
| A0A1R3RA85 | 1-300 | None |
| A0A4R0RIX6 | 380-581 | None |
| A0A162N283 | 33-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.