DPCstruct | MC59156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 110 ± 11 aa |
| Standard deviation of domain lengths | 11.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 15.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14132 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A255EI47 | 42-155 | QWFTAVQNEQAFDASQKVVRTPEGEIQGLYVLGQGVTTVLPWEPVLDIGYRRQLRPDDINRWLLVIMEDGVDGIRTVGEADYSAAMR… |
| F9EPU4 | 83-208 | KEFSKFCEDIQYIDAYSAKQFFVDDKKINEKWAYYVLTENLRTVLPYKPSVEIFSMNYIKNEEVAFWKIFFCACKVDENGKEGIEKI… |
| A0A374I5Q2 | 32-136 | None |
| A0A386ZAF1 | 89-190 | None |
| A0A536D5Y6 | 434-542 | None |
| A0A081HXI2 | 222-320 | None |
| A0A2V8WSV6 | 90-192 | None |
| U1Q5B0 | 509-612 | None |
| A0A6G9WN24 | 72-174 | None |
| R7PRW6 | 13-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.