DPCstruct | MC5915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 117 ± 14 aa |
| Standard deviation of domain lengths | 13.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329A3H9 | 2-122 | RKSAKFAFILFMLLLLSSQVKADEEITSAVYFDRAGMKILTGAANITTGWMEFPKNIVLWRQKETNTFVGFIEGVLWGIVHTASRTG… |
| D6CK12 | 1-110 | MRKLVLAVCIFQLVALPLLAQEQYGPERKLGRGLSNFLFSITEIPRQVSMVRQDNGTFAGVTWGLVKGMSCFAGRTILGAYETVTFL… |
| A0A1G0Z238 | 158-272 | None |
| A0A2P5N1Z9 | 6-119 | None |
| A0A250KTH0 | 1-100 | None |
| A0A1V5FQJ3 | 20-142 | None |
| A0A356VAJ3 | 10-125 | None |
| A0A410P2F7 | 2-109 | None |
| A0A1G1K3Q0 | 12-118 | None |
| A0A3M0ZJU9 | 10-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.