DPCstruct | MC59141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 802 |
|---|---|
| Mean domain length (aa) | 142 ± 34 aa |
| Standard deviation of domain lengths | 34.15 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.73 |
| Pfam Score | 96.37 |
| Assigned Pfam label(s) | PF06421- CL0029- PF11961- CL0395- PF06844 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q54RP1 | 135-292 | NNSYYNKRLKFDKDFRILLLKSLGIMFLVRTYVVELTYCQGTSMEPTINTGDFIFINKLSKDYKVGDLITAACPTNQFSICKRIRFV… |
| A0A285QVE8 | 2-95 | LRAVLAAAGRARLRTRGESMLPAIVPGTVVTVEALPLPRVVPGDVVAAAVGARIIVHRVVATAPDVLLTAGDNLPLLDPVVGPDGYL… |
| A0A7C5YZT4 | 7-125 | None |
| A0A6T7HGH5 | 270-413 | None |
| A0A523QD72 | 254-402 | None |
| A0A811MPL1 | 82-227 | None |
| A0A3D5DU55 | 2-107 | None |
| R5M1Y7 | 196-315 | None |
| A0A523QEB7 | 33-159 | None |
| A0A0E0GU76 | 289-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.