DPCstruct | MC59140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5993 |
|---|---|
| Mean domain length (aa) | 109 ± 21 aa |
| Standard deviation of domain lengths | 21.49 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.10 |
| Pfam Score | 85.79 |
| Assigned Pfam label(s) | CL0221- CL0020- CL0015- PF16366- PF09004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6TU14 | 28-109 | MFPPDACLFVGNISSGKSKEQQENDLKEMFSTYGPCYPKVKIDKNKGLPGAFVQFEKVEDAINALELNGKTLHERPLRIERA |
| Q54J52 | 7-109 | LTKGVNKKNVLYVGGISDDVTIDILRAAFIPFGNINDVILPMDHKTQKLKGFGFIDFELPEDAADALDNMHESEIFGRVIKCSIAKP… |
| A0A1B0BIV4 | 102-218 | None |
| M2RXU5 | 1-105 | None |
| A0A446J3X3 | 7-129 | None |
| A0A5N3VP78 | 39-126 | None |
| A0A3Q4H8M5 | 14-112 | None |
| A0A7S2XLH5 | 58-208 | None |
| A0A1B0BJ76 | 89-189 | None |
| M2SCL1 | 5-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.