DPCstruct | MC5914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 148 ± 8 aa |
| Standard deviation of domain lengths | 8.09 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0D1Z7 | 21-165 | ELMDGPTVVAMLERENELRLSTRVQELYAAAERRSDTDWMEVTLELQKQVATEFGYGPDHDRHDDVLVVLRRAAAIYPELPETAAIP… |
| A0A818BYJ9 | 20-159 | NSNSSTLPTSFIPKSLLKRMLIRENELRLSNEYQKRYCDAEQSPSSSWLDITDELQRQVIREFNLEDEMHEALLCLRCATQIYPDLQ… |
| A0A6C0H5H2 | 7-141 | None |
| A0A2I1GER2 | 636-791 | None |
| A0A812TP74 | 290-436 | None |
| A0A7S4JJ42 | 76-223 | None |
| A0A7S2R5G0 | 24-178 | None |
| A0A822EJ17 | 144-290 | None |
| A0A2H5R744 | 350-517 | None |
| A0A2Z6QGH0 | 503-647 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.