DPCstruct | MC59138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 142 |
|---|---|
| Mean domain length (aa) | 218 ± 37 aa |
| Standard deviation of domain lengths | 36.64 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 18.27 |
| Pfam Score | 98.17 |
| Assigned Pfam label(s) | PF05564- CL0644- CL0322- CL0267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q54ED0 | 12-221 | YFFCFTLLVKSQGPFPYNTTEGCSIFGNNATFVKNSQFPPYNSVSITSGTCQASHPEYSQKACCYTYQTNGLKTFIQSNETLFGQCP… |
| A0A443S122 | 7-210 | FGPVPCAFTGAPDPLTDDEAKAAMKEMCPHLASEAALCCDKDQILEMRSSFEIYGLFLKKCPSCFLNYQKIFCHLYCSPKQNTFAKV… |
| A0A6D2J7R3 | 22-191 | None |
| W5MF72 | 6-215 | None |
| A0A226EL61 | 32-288 | None |
| A0A6S7GCY5 | 6-187 | None |
| A0A6S7GKT3 | 2-221 | None |
| A0A7R9PVW4 | 9-251 | None |
| A0A7R9AU50 | 85-346 | None |
| A0A2P2MG78 | 29-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.