DPCstruct | MC5913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 6.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 72.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10598 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818AK07 | 1-74 | MTGLPQTFNDFLTFQEVIIEIEHPIRLYCRYIDRIHMFFRFTAEEARDLIQRCLTEHPDPNNENIVDYNDKNVG |
| A0A2H1CAG4 | 46-127 | GLERAAEMSGPPQMPNDFLQFQDTATEVAHPIRLYCRYVDRFWMFFRFSAEEARDLIQRYLTEHPDPNNENIVGYNNKKCWP |
| A0A7J6RI26 | 52-122 | None |
| A0A0G4KG05 | 322-403 | None |
| T1GR84 | 111-192 | None |
| A0A4Y1R780 | 63-131 | None |
| G3IPR4 | 1-66 | None |
| A0A6G1DHY5 | 1-66 | None |
| A0A3P6EKI1 | 172-242 | None |
| A0A1S4BZA2 | 496-577 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.