DPCstruct | MC59129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 77 ± 11 aa |
| Standard deviation of domain lengths | 10.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4IVK9 | 5-67 | FERVFEINRNFRNEGISVRHNPEFTMMELYMAYADYKDLIELTESLFRTLAQTVLGQNRSAVW |
| A0A5N9VZT6 | 6-89 | LIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADYHDIMDLTESMVRHIANEVLGSAKVQYNGETIDLESAWTRLHIV |
| C4JVN1 | 135-203 | None |
| A0A846KKE6 | 60-113 | None |
| A0A381G847 | 1-74 | None |
| A0A6A2Y926 | 74-146 | None |
| A0A1V5JX99 | 91-172 | None |
| M7Z141 | 329-417 | None |
| K3X5S6 | 72-144 | None |
| A0A354VJ75 | 217-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.