DPCstruct | MC59126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 124 ± 13 aa |
| Standard deviation of domain lengths | 13.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090PIN0 | 2-106 | RVLDVVHPDSSENPWKSESLRYRNQLIVNMFFAIGCRRGELLKIRVKTDRNSSDIKKRDKDGRYFVMLRAKTDHTDKRKHRPEGKTL… |
| A0A385FZY6 | 1-126 | MLSLYGIITPSSAQKHNPLNPFPSGHLQFRNFLIIRLLLNYGLRTGELLLLECSSIKPNLKGDKFSLIVTTVDEAYEPRKNAPSLKN… |
| A0A2W0EX12 | 153-276 | None |
| A0A8B3HG59 | 60-198 | None |
| A0A7Y2VTU6 | 190-311 | None |
| A0A3M7LHJ9 | 14-154 | None |
| A0A290Q0R9 | 32-170 | None |
| A0A4R1MGE2 | 135-252 | None |
| A0A2Z3HY10 | 143-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.