DPCstruct | MC59120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378FS12 | 1-109 | MNPMPGGSIDNCITFQPVQNHVVIGDDSTIDFSKYYHFIALPDLRVFANAGFPYSRMADLSDTLVVVPKAPTQGQVATLLQALGGIG… |
| T0IXW8 | 26-146 | QNELIFDYNLLLANKKKCEGTLPENVRVAIQPTSTIDFSHAYHALQMPDLATFAGAGYPFTIRPDLAETMVIMGGNPSPGAVEAFLG… |
| A0A5N9VXR7 | 73-193 | None |
| A0A6M5Z888 | 20-124 | None |
| A0A1W9F0P9 | 6-128 | None |
| A0A377BUW3 | 77-197 | None |
| A0A7D5KWE9 | 485-601 | None |
| A0A7Y1FB75 | 1-100 | None |
| U3TSR8 | 220-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.