DPCstruct | MC5912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 134 ± 23 aa |
| Standard deviation of domain lengths | 22.83 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5Y471 | 165-269 | FAKIYPFVEEDVECVGVKPNNLSDIHEEWRKWEENDFLLHGYNRFRHIIVGRKPKEKGYEYFLGIPGIYINQEERIANSYGFAQFVP… |
| R6FPB9 | 21-132 | GVFTIDETGSKWHRETNVDILKTFCREGYAMAKKHGHFIVGTGGEKNYIGIPGRFLVEDQPAGGKTGFTLWQPLRGGEEMYGSLENI… |
| A0A3R6SH94 | 9-143 | None |
| A0A1S9C9P6 | 475-595 | None |
| A0A3A9D5J6 | 390-530 | None |
| R6RLG9 | 300-426 | None |
| A0A1V2YFT9 | 253-373 | None |
| A0A1C6K1K2 | 637-786 | None |
| A0A7X9CL63 | 96-283 | None |
| A0A845QGV3 | 111-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.