DPCstruct | MC59114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 213 ± 39 aa |
| Standard deviation of domain lengths | 38.70 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01959 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4XTC3 | 28-205 | EELEVTKISHIGMGERACVDTCSNFAKDEGILIGSYSQGMILVSSETHPLPYMPTRPFRVNAGAIHSYLVSSVSQTNYLSELSSGHK… |
| A0A810Z701 | 28-232 | IFSPVEHDVMSDFLNRMSDRGNKDITIQVGTVMDSRPVGMGYRACIDTATLFQPDEAILVGNTSQGGLLCCAEVFFLPYMELRPFRV… |
| A0A5J4Z2J6 | 243-492 | None |
| A0A2K1JDT1 | 464-679 | None |
| A0A835IXQ3 | 493-722 | None |
| A0A5A7QZD5 | 401-626 | None |
| A0A0A9ULC9 | 1-145 | None |
| A0A1Q9CXF5 | 129-342 | None |
| A0A6D2KS38 | 238-425 | None |
| A9SUW1 | 559-720 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.