DPCstruct | MC5911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 210 ± 27 aa |
| Standard deviation of domain lengths | 26.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T6DHB9 | 6-203 | IKYSQDKTEYEKCIMRGGNGIEEARLWRDRIVGRLINEIKLNFTAYKAQVFTRRASAGMFTDLTQLGISSAIAAVGGSEIKALLGLA… |
| A0A560KWX2 | 9-207 | LGGCNWTGSLGGPERVAPISDEITEMRAYANSYADLFRGTAAEQMSARNNMIAARMYVIDIEYTQYEAQLMHEGQIVDFSTKVTSGV… |
| A0A2T5GJ58 | 11-251 | None |
| A0A3A5A426 | 8-230 | None |
| A0A419IYU8 | 47-222 | None |
| A0A396RW09 | 33-241 | None |
| A0A0Q8FRR8 | 1-194 | None |
| A0A1V5CFN1 | 25-297 | None |
| A0A1L3FFD8 | 6-204 | None |
| A0A7G6T065 | 20-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.