DPCstruct | MC591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 142 ± 22 aa |
| Standard deviation of domain lengths | 22.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1VCD8 | 1-149 | MVHARNSFYIIGIKRSEQDKDFDQETYDVQQSIVELVNDRMNTIYDIISKNVVSYGEKDAIIKELYETLPLPKDSKFLFINNNRPKS… |
| A0A1Y2EP94 | 19-165 | NSINARSLFYNLSISKPKNSGSSDNYYVIFINNTLLKSESLKEKHQENKYIFSSLMNEIHNLIIDNKNTFEDINKFNTIKEKKPNSN… |
| A0A1Y1WPQ4 | 121-232 | None |
| A0A1Y1WQ10 | 17-184 | None |
| A0A1Y1WVU9 | 6-183 | None |
| A0A1Y1U674 | 7-170 | None |
| A0A1Y1WZL4 | 6-132 | None |
| A0A1Y1XJF4 | 300-438 | None |
| A0A1Y1WA25 | 3-168 | None |
| A0A1Y1WXY2 | 6-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.