DPCstruct | MC59093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 235 ± 20 aa |
| Standard deviation of domain lengths | 19.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 47.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123- PF04855 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8R858 | 1-233 | MTMKTFGDKPTAFQLEEDGEFYYIGSEVGNYLRMFRGSLYKKYPSLWRRLVTVDERKKIASLGLGPHSLATGISLLRAVEVDEIFDG… |
| A0A3Q1AXD4 | 1-261 | LVRMALSKTFGQKPVKFQLEEDGDFYMIGSEVGNYLRMFRGSLYKRYPSLWRKLASVEERKKIVESSHGQWTRLQPNHGYTQLATSV… |
| A0A6V7VB56 | 3-255 | None |
| E4XQA5 | 1-220 | None |
| A0A6G0YVH4 | 47-265 | None |
| A0A7R9FP31 | 1-251 | None |
| A0A7R9BKU0 | 1-242 | None |
| F2UKK9 | 4-198 | None |
| A0A2U9B9V9 | 1-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.