DPCstruct | MC59082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 246 ± 60 aa |
| Standard deviation of domain lengths | 60.23 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.58 |
| Pfam Score | 91.88 |
| Assigned Pfam label(s) | PF16989- PF06812 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661PGX4 | 3-213 | EELLAASKERIADLLEPVAGGVGEDISYDEQFEEIKNETEKLASLTGESCDWSSIGVTAEEILQEKSKDFRVACYLATCKAREGTLE… |
| A0A368E590 | 92-328 | AGVFDRDDPALEELQEEISKLDMNGLNAVAWDKVQELATDILKNKNKNFVVAGYLALASAQREKIKGLDRGLRMLTCMAEHFWEEGY… |
| A0A1I0ZW73 | 21-265 | None |
| A0A3C0PDM3 | 2-191 | None |
| A0A7W8V7Q7 | 9-321 | None |
| A0A3A0CBW4 | 12-237 | None |
| A0A379AI87 | 199-526 | None |
| A0A1H4BHC6 | 16-324 | None |
| A0A845SLT4 | 1-261 | None |
| A0A0F5K3X9 | 60-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.