DPCstruct | MC5908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 196 ± 31 aa |
| Standard deviation of domain lengths | 31.05 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5YJP0 | 24-247 | SPYVATAAEAMKNYKENEAGIWYKDGADPNDPACRYAFQRLRQSWFSPRVNPKFKFSREDKFYAIGSCFARGIELSLIKHKIAVESA… |
| A0A2U2RYZ8 | 63-237 | YKSEFRISSIGTCFAEEVSKFFNSETKYNYLNLEKNLFDYSANWGRVFTTKNLEQVLLYSLTNKIPIYKELYKGNYFDPLREWIVGL… |
| A0A2U2CG24 | 3-225 | None |
| A0A3C1R511 | 1-141 | None |
| A0A7L4X4L8 | 6-198 | None |
| A0A8A6BK56 | 8-182 | None |
| A0A6A8GVR7 | 33-197 | None |
| A0A017HJ21 | 41-288 | None |
| A0A0P0YZG7 | 589-749 | None |
| A0A5S3SG54 | 395-607 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.