DPCstruct | MC59075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 292 ± 31 aa |
| Standard deviation of domain lengths | 31.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A135LC70 | 22-301 | ASPNFADPNFDPADFLNDTLSPLTVASSQPNASRSPGSVPLAELSTQVQSLLSQISAQNIRLSSTLSQLTDEILRSGGRLAYEVEVL… |
| A0A0C3CXF1 | 13-300 | VNLPKRTQTLLSQLSAHTTRLTTTLTQLTDEILRSGSRLAYEVEVLRGETLGLSEALTDSLQEDVIKFVPGGLEQNLARRQSRVADV… |
| A0A0G4KH13 | 240-593 | None |
| R8BJ65 | 484-768 | None |
| A0A1Q8RYJ2 | 155-484 | None |
| A0A139HD23 | 22-289 | None |
| A0A6A6H4W4 | 26-288 | None |
| A0A5M9K5M9 | 23-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.