DPCstruct | MC59071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 367 ± 48 aa |
| Standard deviation of domain lengths | 48.12 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 37.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5SRV8 | 1-338 | MSDPEKDYKYNILRLHDQKHPTAVAEHNSSLSAKGWNYKAEGLEATANSGTPILCASCHKSNALPGTGVDDIKPLTQALHSKHADVT… |
| A0A7V7MKY2 | 255-574 | ASMPVLCADCHYSPPLDLAGTGPNGNQIGNPTMSATMHLFHGQLTDGQGNPVFPPDGTVEETCYQCHPGVQTQCQRGAMKTGGMLCA… |
| A0A1W1CKB0 | 123-486 | None |
| A0A831RHG2 | 440-819 | None |
| A0A090AIL8 | 460-903 | None |
| A0A836S381 | 1-448 | None |
| J1FBA4 | 204-556 | None |
| A0A6L3EL10 | 1-322 | None |
| A0A0C2V9M5 | 167-501 | None |
| A0A3N5VPP9 | 467-840 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.