DPCstruct | MC59070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 24.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0489 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5PY24 | 191-254 | MVVPVPAVKKHETVNCFIQDGAVHIEFNAEAMQNGYIGDEIVLKREDGRTIKGVVLRKNLVEIK |
| A0A7V4NG68 | 8-84 | KVFIKGEILDMRYTKDVPTVIKGQIVKAYSIVGGVTVSVLAQALEHGYVGNVISVKNLDNGSIIKGTVQQDGTVIVL |
| A0A0N1BAY3 | 64-133 | None |
| A0A2H0FTG2 | 145-213 | None |
| A0A6I1KIR1 | 457-526 | None |
| A0A1Z9P980 | 1-65 | None |
| A0A4Q4XER6 | 219-290 | None |
| A0A3B8N3G1 | 4-72 | None |
| A0A349YCJ3 | 251-319 | None |
| D6LRI2 | 14-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.