DPCstruct | MC59068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 158 ± 20 aa |
| Standard deviation of domain lengths | 20.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6MIL6 | 45-188 | MVEMLTPLAQTGQCGGYLQWRPVVYTSPDRDMTSSTETVEYAVAAPAEPLRTLNHTLLYSLLGNRLDEMLVVATNITFGEAGDGFFR… |
| A0A060XEF2 | 26-169 | SSPVNSTSPVLGYAQWKPVAYRRPSPVFEDATPCRHSTPVPVAQLPPSGLVQAYFGGEHQTTGLNMTFSITGDPFYNTTNYLSWTVL… |
| A0A7R9AA93 | 230-373 | None |
| A0A2W1BJJ1 | 727-890 | None |
| A0A4C1U6A4 | 129-277 | None |
| A0A6V7HEH1 | 367-519 | None |
| A0A6I9NDY1 | 8-145 | None |
| A0A3P7M2X0 | 6-170 | None |
| A0A672UY82 | 196-342 | None |
| A0A5K3EJ94 | 62-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.