DPCstruct | MC59067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 8.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060XD41 | 16-124 | EVYQTRVTKHLVPCVGQFCVAVGDDTLWKTLNYQILLKTRHSSSKVRFSALLMLLELASKLRENYMVLLPETIPFLAELMEDECEEV… |
| L0P8R1 | 127-245 | MAPVLISHLSFTPRYKVDKYLIPSIAQLAAITVSDEHYKTINTLVLTHMNSDNASVRLAALETQKELYTRVKEEWLVTLPQTIPFIL… |
| C9SUW1 | 310-411 | None |
| A0A6L5CU51 | 508-617 | None |
| H2Y6G8 | 2-91 | None |
| E9I3S2 | 119-224 | None |
| A0A077ZJY6 | 1529-1642 | None |
| A0A6A4X191 | 602-705 | None |
| A0A443RUY8 | 5-108 | None |
| A0A2P4YHT4 | 65-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.