DPCstruct | MC59063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 121 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060X5E3 | 3-125 | GERIKYKLSAMPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIDEERPIRLMLGTCPTKEDKEAFAIVS… |
| A0A3M7S5B6 | 124-241 | YLVSVTNAFDHSTIFELDETTITIHDSPVPRNSYVRLKHWETGTWVHSTALLIDKEEEKPVMWKIGCAKIKEDKEAFQLIPVPTNEV… |
| A0A183KU19 | 6-104 | None |
| A0A7J7KKU0 | 237-352 | None |
| A0A060XBB5 | 21-144 | None |
| A0A817JPM8 | 189-304 | None |
| A0A6I9MXC0 | 168-291 | None |
| A0A7E6EH83 | 402-508 | None |
| S7Q2D2 | 671-794 | None |
| A0A821B8V7 | 132-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.