DPCstruct | MC59060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 149 ± 14 aa |
| Standard deviation of domain lengths | 13.81 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 62.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060X0A5 | 1-134 | MTVVSMDGLIQEEPFQAVLQYLYTGSLDEGRGDLMQVATIAELLEVFDLRMMVANVLNRESFMNQEITKAFHVRRANRIKECLSKGT… |
| A0A2U9BS89 | 278-430 | RGFLSVCLEHVDDPMTGRPRLMTVVAMDALIQEEPFKAVLQYLYTGSLDEGRGDLMQVATIAELLEVFDLRMMVANVLNRESFMNQE… |
| A0A7R8WI39 | 316-491 | None |
| A0A834FCP1 | 361-513 | None |
| A0A1V4KRY3 | 1-127 | None |
| A0A402EIG2 | 373-526 | None |
| A0A6P3HVC7 | 49-193 | None |
| A0A3Q3A6R4 | 737-889 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.