DPCstruct | MC5906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Standard deviation of domain lengths | 4.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6MJL9 | 1-70 | MTITHPLYASQNGDRWSLCRGADVADVYVLHEANPASGGQMSRIALGPFLAGPAGAPERQEALRLIGALM |
| A0A2V5Y837 | 1-73 | MSMTTSVVKGLYNSPNGDRWALCRDQSGKLVVSHQPNHASGGRASEIGVEAFLSQPRSGPEHQALIEALAHLD |
| A0A017HM28 | 2-68 | None |
| A0A1P9YD09 | 1-71 | None |
| A0A7J4VJG5 | 16-90 | None |
| A0A4V1RJ33 | 11-80 | None |
| A0A7W8GPU3 | 104-172 | None |
| A0A1M5S4B2 | 71-133 | None |
| A0A7W5XIR5 | 16-74 | None |
| A0A7W5XIQ3 | 48-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.