DPCstruct | MC59059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 299 ± 29 aa |
| Standard deviation of domain lengths | 29.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.49 |
| Pfam Score | 81.82 |
| Assigned Pfam label(s) | CL0229- PF08429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060X037 | 15-317 | TYLKKQLMIIINFLVCFPHMSHSLQCGSNYAYLEQLESLLARGRSIPVRLDPLPQVESQVASARAWRERTARTFLKKNSTYTLLQVL… |
| A0A0N4XKY2 | 2-262 | ARMREELVRVRRVLSRISDSERDISLNEYMDLTKACENSSFLINSETHKSVLAIKDNLLNFTQRLVNLFQKPTSYYNLVEIIRDRDD… |
| A0A6L2Q172 | 72-425 | None |
| A0A1U8GDW6 | 250-542 | None |
| A0A0S7LBL3 | 4-320 | None |
| A0A6G0WEW0 | 23-317 | None |
| A0A287Y1W0 | 399-661 | None |
| A0A1E3PJD9 | 541-847 | None |
| A0A1Y1YBB5 | 912-1267 | None |
| A0A060WQ28 | 52-389 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.