DPCstruct | MC59053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 183 ± 20 aa |
| Standard deviation of domain lengths | 20.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060WMA0 | 1-188 | MPSNKRTTSATAMTSSTLWKNTITKRTASSKLRTTPLIQTPTESAPSMTTDNMLLCGTLKHLDECKYKIPPLEKRYDLHNMGSKTVY… |
| A0A7J6AL15 | 1-147 | MHTRQKGKLDTCESYKDLDSCHYQIPALREKFGLRNAEHTTLYHCNCTARLARELAEEVEVDKVHFWLLDFVSQSCFFLPQNCTGSE… |
| A0A2P4SM16 | 1-197 | None |
| A0A2I0TXG4 | 151-322 | None |
| A0A151NDH5 | 242-446 | None |
| A0A4W5QT68 | 197-399 | None |
| A0A6G0ILF0 | 207-358 | None |
| A0A341D9S8 | 205-403 | None |
| A0A1S3PGR9 | 522-709 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.