DPCstruct | MC5905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0IM68 | 3-82 | KATLRDTVWDELESSGEARFPFPPHGRIPNFADARAAADALAETSEWADADTIKANPDAPQLPARRRALREGKTVYMAVP |
| A0A1C5ALT6 | 3-88 | IDEAKREVRETVWSRLERAGQALPPGAHGRIPGFIGAERAAQRLTAHDAWRSARVIKSNPDKAQLSVRLQALAEGKLLYMAVPNLG |
| A0A7V3M9B1 | 5-86 | None |
| A0A2W1BPP0 | 20-97 | None |
| A0A1D5RMI9 | 1-65 | None |
| A0A1D5RM24 | 9-81 | None |
| A0A7F8RT55 | 56-140 | None |
| A0A534NS24 | 5-78 | None |
| A0A817TGD0 | 251-341 | None |
| A0A418V1D9 | 2-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.