DPCstruct | MC59047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 221 ± 44 aa |
| Standard deviation of domain lengths | 44.49 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11204 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N4XFS6 | 38-277 | HSRRAKFKRTMKGFGRYVRNPLGFIVTLYFFLITFWGAAWVLFLIGWIYVGHRQDYFVEIADQILTALFCVVGITMFPFRLVDTYHM… |
| N1JMM9 | 54-294 | IKLLRINSMASRLKRPCKFFFTPLGFLITIYGLNIVAWGGMLFLLICNAAPKMCKPSCDDINSARNIWIEIDSQVLNALFCVTGFGT… |
| G4ZNW5 | 8-243 | None |
| A0A4S4DIV2 | 57-263 | None |
| A0A4U0VBA9 | 2-258 | None |
| K2SY89 | 59-269 | None |
| A0A2N1N318 | 69-286 | None |
| W2PGP0 | 4-232 | None |
| A0A433DK53 | 26-243 | None |
| A0A397SDK6 | 45-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.