DPCstruct | MC59046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 123 ± 9 aa |
| Standard deviation of domain lengths | 8.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 47.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1JBT4 | 40-148 | TQSSINERVTAQKTATKADCPPELRPIVEAGQRCAAETAANLALYSAAISGVEATIFPLTNGSNRQFLDSMRVYLRAAIAQYMATGP… |
| N1JFZ1 | 1-128 | MKESLPKAATKAECPPELRPIVEAERRAAKTAANLTLCSAAIFGVEATLFPLTNGTNKLFVDSMRVYLRAIFAQCMATGPASTPPVL… |
| N1JHG1 | 96-228 | None |
| N1JP27 | 1-116 | None |
| N1JN34 | 93-226 | None |
| N1JH80 | 39-156 | None |
| N1J8D6 | 70-184 | None |
| A0A0B1P587 | 134-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.