DPCstruct | MC59043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 236 ± 26 aa |
| Standard deviation of domain lengths | 25.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1J5E0 | 34-262 | INGFVCDLEFHSIDHVREVAKKGVEAFFYRKRALKFPKTFEDTKLFNVKSDILLSWPIMSSRLFYTRTPGNSRLIINTRGQIMGIVV… |
| A0A0B1P2Y6 | 136-352 | FDTLGNIKGALVKGLHDNYLRCIRKRVAPTAPASDPLSKLFVPAPKPGYMCGRTFFEDENLKEAAEIALRISTQNLKKSIYAKSQFP… |
| A0A420IUD2 | 136-402 | None |
| A0A2S4PNM0 | 2-253 | None |
| N1JPD5 | 31-246 | None |
| N1JHZ7 | 38-326 | None |
| N1JD79 | 8-235 | None |
| A0A420J814 | 1-198 | None |
| A0A656KKR6 | 13-233 | None |
| A0A0B1NZL4 | 41-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.