DPCstruct | MC59042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 10.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.51 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | CL0016- CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0RPZ0 | 40-132 | SKLLMISRREGDDIIRYAHIGTGNFHEKTARIYTDFSLLTADQEITNEVRNVFGYIENPYRPVKFNHLMVSPRNSRTQIYRLIDNEI… |
| A0A3G9M915 | 2-94 | QTCLVVVRREGSTIRRYCHIGTGNYHPKTARLYEDVSLLTALPEIGADLTDLFNSLTGYSRKTQYRNLLVAPYSIRPVIIERIDAEV… |
| A0A836ZKS0 | 337-450 | None |
| A0A2N6V5H4 | 664-777 | None |
| A0A644Y4R0 | 374-486 | None |
| A0A2H6A6Z4 | 801-916 | None |
| A0A380ZUW6 | 42-173 | None |
| A0A162KT02 | 434-542 | None |
| A0A316P363 | 478-585 | None |
| A0A6I1IZF6 | 136-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.