DPCstruct | MC5904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 485 ± 39 aa |
| Standard deviation of domain lengths | 38.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9Z0G3 | 185-607 | AVLKKNKKERRTEANIKKTIALFDDVPLIKQSSLAEAWPAEYRLEESDKDKGEDEDAPAEEAERAPKASDDVLVTAAIAALIQGGDS… |
| A0A1V1SYN7 | 1-455 | MYPTSFELLPLISNHSPPRPLRDQALMTLISSTRQIEQFDISIFERPRQIPGFQKLLYGAIHEHLGLLSRSRSAGQLIGLAFSGSQH… |
| G4U523 | 211-770 | None |
| A0A0C3C548 | 1-492 | None |
| A0A1L9T5N3 | 18-516 | None |
| A0A1Y2V6W7 | 248-674 | None |
| A0A0G4LSW6 | 497-972 | None |
| A0A2C5ZFR9 | 60-573 | None |
| A0A066XYR8 | 309-774 | None |
| A0A094E8W6 | 486-1020 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.