DPCstruct | MC59034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 453 ± 37 aa |
| Standard deviation of domain lengths | 36.65 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5W403 | 561-1004 | CSVLYNNDWYTLQDALYLAQENDTVIVAENTVASNSSAYCGDAYYTVKKGVTLLVPYDKDHSTNTKDIQRCYENGVSVPAVGTAYRT… |
| R9T6F8 | 1-460 | MQNKHKLALAAGCLVLAALCFVAAGVSEDSDFDNEAVLAAGDAPAASIGDVTYASLEEALNAAVSGQTVVLIDDYVMTSNAAVKAGV… |
| A0A349ESZ3 | 1-398 | None |
| A0A7C6NAN7 | 292-715 | None |
| R7FKE4 | 339-786 | None |
| A0A7C6J0C0 | 275-797 | None |
| A0A0X8V2L1 | 41-515 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.