DPCstruct | MC59032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 65 ± 10 aa |
| Standard deviation of domain lengths | 9.96 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2LR36 | 518-581 | LPSAAPGDLDGDSAIDRNDLDLVLNAVGTDATAGGDPRDLDHDGRITVLDARKLTLLCNKPQCA |
| A0A7W2RY23 | 1-56 | MDGFVDRSDIRLIAAARNQPTAPVSPHDNDGDGIITVSDALQRVQLCTLPRCAPQP |
| A0A7C0XI65 | 443-507 | None |
| A0A318CNL9 | 622-720 | None |
| A0A7R9RDF5 | 654-716 | None |
| A0A3D0SRP3 | 180-243 | None |
| A0A496U0C8 | 429-490 | None |
| A0A850TDC3 | 1028-1094 | None |
| A0A3M8EI25 | 244-301 | None |
| A0A2M7P519 | 218-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.