DPCstruct | MC5903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 177 ± 20 aa |
| Standard deviation of domain lengths | 19.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6YX92 | 1-211 | MRGAQSWWGASLAYYENAGIYTSALLDAYMDYKSIWKHIQVTNWEFESGITNLVKSTPTKELLDYAKECANEPPPAQKPATRDQTST… |
| A0A1V1SYD1 | 3-162 | AFEMGGVYATILQETYLDFKTVAKNLQVLAYGVPASQTKLIAASESSDIGHATSEAPQPAESTPRNNDEVGSKSDQKQQPLEERPYS… |
| A0A4Q4SPE9 | 36-213 | None |
| A0A366P4C2 | 463-649 | None |
| A0A5N7AQ81 | 122-269 | None |
| A0A2T3A385 | 597-771 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.