DPCstruct | MC59024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 160 ± 27 aa |
| Standard deviation of domain lengths | 26.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z9KZF7 | 91-272 | MGTLLGVFLPCLQNILGCIYFVRLSWIVGQTGIQMALLVIGLCCCTTFLTSLSLSAIATNGAIKGGGPYYLISRALGPEFGGSVGLC… |
| A0A3D4B8E4 | 2-124 | RLPWNVGQAGLFAAAGIIIVAHILSFSTGLSVASIATDKKVKAGGIYYIISRSLGLPIGGTLGLALFVGLSLSISLYIIGFVESLLP… |
| A0A0D8XSI3 | 1-168 | None |
| A0A835GT50 | 158-327 | None |
| A0A654H293 | 19-187 | None |
| A0A6V7TH38 | 143-321 | None |
| A0A044R3G0 | 16-221 | None |
| A0A3P6RNQ2 | 2-117 | None |
| A0A0S7J5P8 | 83-249 | None |
| A0A7R8XAD4 | 17-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.