DPCstruct | MC59023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 156 ± 14 aa |
| Standard deviation of domain lengths | 13.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9CND4 | 5-156 | NQLMENEINKENNNIKRSVISSDLLDLLDFVNVDGCLFFKFQKIDNNISTVDLNDVSRQFLDLSGYELSINRFHIDDYVSNNILCQS… |
| A0A6J5GZU0 | 117-258 | MKINGPMRNLLRSTQASRVLAPSLSEIVRDGFEVRDGCSVLRALSKHANVPRARFTDCTGYECFVNSLHVEDYIAEMPFEQALLFVG… |
| A0A3A8V5P5 | 2-162 | None |
| B4VNF2 | 16-165 | None |
| A0A0F7CNP4 | 3-159 | None |
| A0A099RVQ1 | 3-122 | None |
| A0A4P7GYX3 | 1-169 | None |
| A0A7K3KB92 | 20-166 | None |
| A0A3N4YST5 | 116-275 | None |
| A0A3G9A8A8 | 2-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.