DPCstruct | MC5902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Standard deviation of domain lengths | 13.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 54.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0S5Q6 | 1-90 | MGVQKKTRKFAAVKRVIGQRDARLKKNIVAEEAKQKEKTKGKDDLIREIPQVPSSMFFQHNTALTPPYSVLVDTNFLSHTVHHKLPL… |
| A0A1V1SVM4 | 1-104 | MGVAKKTRKFAVKRIIGQRDARLKKNAGKADAQNPQKAKTGGPSNDQVVREIPQMPSGLFFQHNQALKPPYSVLLDTNFLSHTIQRK… |
| A0A7R9PB27 | 1-98 | None |
| A0A4U1F1E0 | 349-464 | None |
| J4HSY3 | 19-102 | None |
| A0A4Y7KNW5 | 1-84 | None |
| A0A6C1LW22 | 1-127 | None |
| A0A836CYG6 | 3-102 | None |
| A0A093V414 | 1-95 | None |
| A0A6J0DPZ3 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.