DPCstruct | MC59010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 162 |
|---|---|
| Mean domain length (aa) | 464 ± 132 aa |
| Standard deviation of domain lengths | 131.85 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 75.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.90 |
| Pfam Score | 91.46 |
| Assigned Pfam label(s) | CL0220- CL0307- PF01294 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9C7E1 | 123-857 | IMYTLYPGGYEATSPEYVFYGGVAAGIIYVSLVMSLRCGISLQMFALSNFASTWMDFLNEKHEATIMPPWTPGWSIQQDTLTQNFVC… |
| A0A816A4A9 | 100-605 | NNCMNELKSSLLNLSLCQSLFISCLIPHSSITRDEVLNHLTNLQLSFDTVHSLYIKVRFQSIENTFQSDDDLSHAFFLFQLNSIVQL… |
| F4PH54 | 507-987 | None |
| A0A167WJ93 | 14-646 | None |
| A0A165WZM7 | 335-867 | None |
| A0A820BWA6 | 4-430 | None |
| A0A2W6AFJ8 | 29-374 | None |
| A0A3M6I2V0 | 413-963 | None |
| A0A0P1AZF1 | 2-553 | None |
| A0A662WMW3 | 14-729 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.