DPCstruct | MC5901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1L287 | 3-73 | SEGCPGGLTNTVPLCCATNVLGVATLDCSTPTVPVPNVGIFQAHCASKGKQPVCCTVPVAGLGLLCQKPTG |
| A0A1V1SUU2 | 272-346 | PTGGNYVACPAGLYSVPQCCATDVLGLADLDCHSPAAAPSNAADFRNICAAGGQQARCCVIPLLGQSVLCITPPG |
| W6Y8D8 | 12-93 | None |
| A0A194XJG9 | 9-84 | None |
| W7MJ40 | 44-124 | None |
| A0A553IE92 | 176-254 | None |
| Q9UVI4 | 31-133 | None |
| A0A1B8A923 | 11-92 | None |
| A0A0C3DDP7 | 11-90 | None |
| A0A5P8PBG7 | 42-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.