DPCstruct | MC59001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 581 |
|---|---|
| Mean domain length (aa) | 222 ± 63 aa |
| Standard deviation of domain lengths | 62.91 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.29 |
| Pfam Score | 32.44 |
| Assigned Pfam label(s) | CL0023- CL0137- PF02272- CL0094- PF02724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6XFP7 | 43-254 | YKNFFIIDHHHGPYFDSANIYVDTTASATAVLVFDVIKKMKQNINNLVATYLYLALHYDTGGFYYTNTNEKCLKVASKLLEYGVDMS… |
| A0A7C2AUG4 | 6-131 | VEERLHFYMEHEEYFEMQIRKCSKLHDKLVIVDLRDEEIIYAGNRFTIYAIFPDCNISIQITHSADGGQTIFATGKSIINRTSKTNI… |
| A0A6J7RV48 | 59-249 | None |
| A0A662QCE4 | 5-150 | None |
| A0A7C5J0S5 | 6-118 | None |
| A0A7C5N7M9 | 3-142 | None |
| A0A7R9KSY0 | 78-362 | None |
| A0A7J6PNG5 | 534-805 | None |
| A0A554J7R5 | 31-366 | None |
| A0A820EQ29 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.