DPCstruct | MC5900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 293 ± 35 aa |
| Standard deviation of domain lengths | 35.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9VSL4 | 46-298 | LFGLVQGRPPSTRAPLGNYLARVPERPSVPTGGPELICTERPAARHGLGCGNMVARDCQCVLPHHGPKPVCNACAAEGNARFARAGA… |
| A0A1V1STV5 | 32-306 | IPPDTDRNEIMQLSQGALTIFNVTDDSDLIQPPSPGPKVPPFPRDGMLLFTDTPPAHPNPSVTPGLQKITYNSTMDPSVNENMPCME… |
| A0A6V8QSD4 | 580-865 | None |
| A0A2H3HN19 | 483-796 | None |
| A0A1W2TB02 | 396-741 | None |
| A0A0J9V6T1 | 1-314 | None |
| A0A167WP87 | 767-1102 | None |
| A0A4Q4XIH3 | 56-391 | None |
| A0A423X256 | 732-1008 | None |
| A0A084B9K2 | 981-1257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.