DPCstruct | MC590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 203 ± 28 aa |
| Standard deviation of domain lengths | 27.98 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2EP08 | 7-220 | KTLLSIVAFGMMTKAATIPTLNEKECKNTYNLITKCILLVDEENGGRHACEVFESSECQQLFENADKKLSNCQFEDDMITADYIKAF… |
| A0A1Y3N7H9 | 15-169 | SATALPFKRAEKCNNEILSMLQSCNSDCSVFSSEKCQNFFSNPFDIDSGCDTLSKEEKNTLYITVKEKQAISSLYCYKDTDGNQCPF… |
| A0A1Y3NG40 | 702-958 | None |
| A0A1Y1VSY1 | 16-218 | None |
| A0A1Y1VTP7 | 1-254 | None |
| A0A1Y1VUG2 | 13-208 | None |
| A0A1Y1VWG9 | 21-206 | None |
| A0A1Y1WIQ7 | 1-223 | None |
| A0A1Y1WPC5 | 42-280 | None |
| A0A1Y1WPT0 | 85-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.