DPCstruct | MC59
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 65 ± 9 aa |
| Standard deviation of domain lengths | 9.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 49.61 |
| Pfam Score | 87.80 |
| Assigned Pfam label(s) | PF04926- PF04928 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7XR39 | 63-122 | MPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKGEWSKLFEAPNFFQKYK |
| A0A161ZMH7 | 1-70 | MPIITPAYPCMNSGYNVSTSTLRVMREQFQFGNKICEEIELNKSQWKDLFEPCMFFKSYKNYLQVDIVAA |
| A0A6A5D3F0 | 1-57 | None |
| A0A444SKK8 | 1-71 | None |
| A0A7J8Y3A4 | 47-100 | None |
| A0A835KYF4 | 163-238 | None |
| A0A5K3G4Z0 | 20-79 | None |
| A0A834KAZ3 | 34-93 | None |
| A0A1Y2ECP7 | 38-97 | None |
| A0A2G9SG33 | 33-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.