DPCstruct | MC58998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Standard deviation of domain lengths | 6.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420IYB7 | 1-99 | MALVNSSRYWKDNIRIFKVKRDEETGVQIVVKIKIGVRLKDAINSSYTQDDISIIIAINAMKILVYAKAKENPVSPPELFGCVLGDH… |
| A0A1Z5T6E0 | 1-89 | MASLSYARYGKDNVRLYKVQRNDNGTQDVTEMTVCTLLEGDIAESWTKADNANIVATDTQKQTVYVMAKLHPVNPPELFASILANHF… |
| A0A843X3V0 | 1-90 | None |
| A0A445EEG7 | 11-94 | None |
| V2WHE9 | 7-94 | None |
| A0A060S7V7 | 1-82 | None |
| A0A553HVH3 | 772-862 | None |
| A0A835JWS1 | 1-101 | None |
| A0A166J880 | 101-201 | None |
| A0A535MXG5 | 2-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.